PDB entry 1ve0

View 1ve0 on RCSB PDB site
Description: Crystal structure of uncharacterized protein ST2072 from Sulfolobus tokodaii
Class: metal binding protein
Keywords: Structural genomics, Zinc binding protein, METAL BINDING PROTEIN
Deposited on 2004-03-26, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein (ST2072)
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST2072
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96YV5 (0-133)
      • modified residue (0)
      • modified residue (57)
      • modified residue (131)
    Domains in SCOPe 2.07: d1ve0a_
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ve0A (A:)
    mkiiskeftvktrsrfdsiditeqvseaikginngiahvivkhttcaiiineaesglmkd
    flnwakklvppdgefehniidnnghahvisaiignsrvvpiiegkldlgtwqriillefd
    gprtrtvlvksmge