PDB entry 1vdz

View 1vdz on RCSB PDB site
Description: Crystal structure of A-type ATPase catalytic subunit A from Pyrococcus horikoshii OT3
Class: hydrolase
Keywords: A-type ATPase, catalytic subunit, Archaea, HYDROLASE
Deposited on 2004-03-26, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.239
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A-type ATPase subunit A
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdza1, d1vdza2, d1vdza3
  • Heterogens: MPD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vdzA (A:)
    mvakgriirvtgplvvadgmkgakmyevvrvgelgligeiirlegdkaviqvyeetagvr
    pgepvvgtgaslsvelgpglltsiydgiqrplevirektgdfiargvtapalprdkkwhf
    ipkakvgdkvvggdiigevpetsiivhkimvppgiegeiveiaeegdytieeviakvktp
    sgeikelkmyqrwpvrvkrpykeklppevplitgqrvidtffpqakggtaaipgpfgsgk
    tvtqhqlakwsdaqvviyigcgergnemtdvleefpklkdpktgkplmertvliantsnm
    pvaareasiytgitiaeyfrdmgydvalmadstsrwaealreisgrleempgeegypayl
    asklaefyeragrvvtlgsdyrvgsvsvigavsppggdfsepvvqntlrvvkvfwaldad
    larrrhfpainwltsyslyvdavkdwwhknidpewkamrdkamallqkeselqeivrivg
    pdalpereraillvarmlredylqqdafdevdtycppekqvtmmrvllnfydktmeainr
    gvpleeiaklpvreeigrmkferdvskirslidktneqfeelfkkyga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdzA (A:)
    rpgepvvgtgaslsvelgpglltsiydgiqrplevirektgdfiargvtapalprdkkwh
    fipkakvgdkvvggdiigevpetsiivhkimvppgiegeiveiaeegdytieeviakvkt
    psgeikelkmyqrwpvrvkrpykeklppevplitgqrvidtffpqakggtaaipgpfgsg
    ktvtqhqlakwsdaqvviyigcgergnemtdvleefpklkdpktgkplmertvliantsn
    mpvaareasiytgitiaeyfrdmgydvalmadstsrwaealpaylasklaefyeragrvv
    tlgsdyrvgsvsvigavsppggdfsepvvqntlrvvkvfwaldadlarrrhfpainwlts
    yslyvdavkdwwhknidpewkamrdkamallqkeselqeivrivgpdalpereraillva
    rmlredylqqdafdevdtycppekqvtmmrvllnfydktmeainrgvpleeiaklpvree
    igrmkferdvskirslidktneqfeelfkkyga