PDB entry 1vdy

View 1vdy on RCSB PDB site
Description: NMR Structure of the hypothetical ENTH-VHS domain At3g16270 from Arabidopsis thaliana
Deposited on 2004-03-25, released 2005-05-03
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein (RAFL09-17-B18)
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RIKEN cDNA RAFL09-17-B18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C5H4 (7-133)
      • cloning artifact (0-6)
      • cloning artifact (134-139)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1vdyA (A:)
    gssgssgesywrsrmidavtsdedkvapvykleeicdllrsshvsivkefsefilkrldn
    kspivkqkalrlikyavgksgsefrremqrnsvavrnlfhykghpdplkgdalnkavret
    ahetisaifseengsgpssg