PDB entry 1vdx

View 1vdx on RCSB PDB site
Description: Crystal Structure of a Pyrococcus horikoshii protein with similarities to 2'5' RNA-ligase
Class: ligase
Keywords: LIGASE, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-03-25, released 2005-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein PH0099
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vdxa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vdxA (A:)
    mrafiaidvnesvrdslvraqdyigskeakikfverenlhitlkflgeiteeqaeeikni
    lkkiaekykkhevkvkgigvfpnpnyirviwagiendeiiremareiedelaklgfkkeg
    nfvahitlgrvkfvkdklgltmklkelanedfgsfvvdaielkkstltpkgpiyetlarf
    else