PDB entry 1vdu

View 1vdu on RCSB PDB site
Description: Crystal Structure of hypothetical protein [ST1625] from Hyperthermophilic Archaeon Sulfolobus tokodaii
Deposited on 2004-03-24, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1vdua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vduA (A:)
    tivkseiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfq
    vldkigsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilkn
    nevsasilvaianalrrvgderdattllieackkgekeacnavntltvrsvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vduA (A:)
    eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki
    gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilknnevsa
    silvaianalrrvgderdattllieackkgekeacnavntl