PDB entry 1vdu

View 1vdu on RCSB PDB site
Description: Crystal Structure of hypothetical protein [ST1625] from Hyperthermophilic Archaeon Sulfolobus tokodaii
Deposited on 2004-03-24, released 2004-04-06
The last revision was dated 2005-02-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein [ST1625]
    Species: Sulfolobus tokodaii
    Database cross-references and differences (RAF-indexed):
    • GB NP_377595
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vduA (A:)
    tivkseiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfq
    vldkigsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilkn
    nevsasilvaianalrrvgderdattllieackkgekeacnavntltvrsvm
    

    Sequence, based on observed residues (ATOM records):
    >1vduA (A:)
    eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki
    gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilknnevsa
    silvaianalrrvgderdattllieackkgekeacnavntl