PDB entry 1vdr

View 1vdr on RCSB PDB site
Description: dihydrofolate reductase
Class: oxidoreductase
Keywords: oxidoreductase, dihydrofolate reductase, halophilic enzyme
Deposited on 1997-11-30, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.18
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Haloferax volcanii [TaxId:2246]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdra_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Haloferax volcanii [TaxId:2246]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdrb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vdrA (A:)
    melvsvaalaenrvigrdgelpwpsipadkkqyrsriaddpvvlgrttfesmrddlpgsa
    qivmsrsersfsvdtahraasveeavdiaasldaetayviggaaiyalfqphldrmvlsr
    vpgeyegdtyypewdaaeweldaetdhegftlqewvrsassr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdrA (A:)
    elvsvaalaenrvigrdgelpwpsipadkkqyrsriaddpvvlgrttfesmrddlpgsaq
    ivmsrsersfsvdtahraasveeavdiaasldaetayviggaaiyalfqphldrmvlsrv
    pgeyegdtyypewdaaeweldaetdhegftlqewvrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vdrB (B:)
    melvsvaalaenrvigrdgelpwpsipadkkqyrsriaddpvvlgrttfesmrddlpgsa
    qivmsrsersfsvdtahraasveeavdiaasldaetayviggaaiyalfqphldrmvlsr
    vpgeyegdtyypewdaaeweldaetdhegftlqewvrsassr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdrB (B:)
    elvsvaalaenrvigrdgelpwpsipadkkqyrsriaddpvvlgrttfesmrddlpgsaq
    ivmsrsersfsvdtahraasveeavdiaasldaetayviggaaiyalfqphldrmvlsrv
    pegdtyypewdaaeweldaetdhegftlqewvrsa