PDB entry 1vdn

View 1vdn on RCSB PDB site
Description: Crystal Structure Of Yeast Cyclophilin A Complexed With ACE-Ala-Ala-Pro-Ala-7-Amino-4-Methylcoumarin
Class: isomerase/isomerase inhibitor
Keywords: beta barrel, isomerase-isomerase inhibitor complex, rotamase
Deposited on 2004-03-24, released 2005-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vdna_
  • Chain 'B':
    Compound: (ace)aapa(mcm)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1VDN (Start-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1vdnA (A:)
msqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfml
qggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwl
dgkhvvfgevvdgydivkkveslgspsgatkarivvaksgel

    Sequence, based on observed residues (ATOM records): (download) 
    >1vdnA (A:)
sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel

  • Chain 'B':
    No sequence available.