PDB entry 1vdn

View 1vdn on RCSB PDB site
Description: Crystal Structure Of Yeast Cyclophilin A Complexed With ACE-Ala-Ala-Pro-Ala-7-Amino-4-Methylcoumarin
Class: isomerase
Keywords: beta barrel
Deposited on 2004-03-24, released 2005-06-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vdna1
  • Chain 'B':
    Compound: (ace)aapa(mcm)
    Species: synthetic, synthetic
  • Heterogens: ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vdnA (A:)
    msqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfml
    qggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwl
    dgkhvvfgevvdgydivkkveslgspsgatkarivvaksgel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdnA (A:)
    sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
    ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
    gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel
    

  • Chain 'B':
    No sequence available.