PDB entry 1vdm

View 1vdm on RCSB PDB site
Description: Crystal structure of purine phosphoribosyltransferase from Pyrococcus horikoshii Ot3
Class: transferase
Keywords: purine phosphoribosyltransferase, Pyrococcus horikoshii, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-03-23, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdma1
  • Chain 'B':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdmb_
  • Chain 'C':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdmc_
  • Chain 'D':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdmd_
  • Chain 'E':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdme_
  • Chain 'F':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdmf_
  • Chain 'G':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdmg_
  • Chain 'H':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdmh_
  • Chain 'I':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdmi_
  • Chain 'J':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdmj_
  • Chain 'K':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdmk_
  • Chain 'L':
    Compound: purine phosphoribosyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdml_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vdmA (A:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmA (A:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamk
    pwtsvvpdyyvfrtekwivfpweefpvieke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vdmB (B:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmB (B:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykggekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpw
    tsvvpdyyvfrtekwivfpweefpvieke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vdmC (C:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmC (C:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    kpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpwtsvvp
    dyyvfrtekwivfpweefpviek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vdmD (D:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmD (D:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpwt
    svvpdyyvfrtekwivfpweefpviek
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vdmE (E:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmE (E:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgiekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpw
    tsvvpdyyvfrtekwivfpweefpvieke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vdmF (F:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmF (F:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidgekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamk
    pwtsvvpdyyvfrtekwivfpweefpviek
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vdmG (G:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmG (G:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpviek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vdmH (H:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmH (H:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykrgekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpw
    tsvvpdyyvfrtekwivfpweefpvieke
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1vdmI (I:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmI (I:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ygekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpwts
    vvpdyyvfrtekwivfpweefpviek
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1vdmJ (J:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmJ (J:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    yrgekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpwt
    svvpdyyvfrtekwivfpweefpviek
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1vdmK (K:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmK (K:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpwts
    vvpdyyvfrtekwivfpweefpviek
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1vdmL (L:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
    mkpwtsvvpdyyvfrtekwivfpweefpvieke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdmL (L:)
    mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
    ykggekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpw
    tsvvpdyyvfrtekwivfpweefpvieke