PDB entry 1vdl

View 1vdl on RCSB PDB site
Description: Solution Structure of RSGI RUH-013, a UBA domain in Mouse cDNA
Class: structural genomics, unknown function
Keywords: UBA domain, Mouse cDNA, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-03-23, released 2004-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin carboxyl-terminal hydrolase 25
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2610101O11
  Database cross-references and differences (RAF-indexed):
  • Uniprot P57080 (7-73)
    • cloning artifact (0-6)
    • cloning artifact (74-79)
  Domains in SCOPe 2.06: d1vdla1, d1vdla2, d1vdla3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vdlA (A:)
  gssgssgmtveqnvlqqsaaqkhqqtflnqlreitgindaqilqqalkdsngnlelavaf
  ltaknaktppqeetsgpssg