PDB entry 1vdl

View 1vdl on RCSB PDB site
Description: Solution Structure of RSGI RUH-013, a UBA domain in Mouse cDNA
Class: structural genomics, unknown function
Keywords: UBA domain, Mouse cDNA, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-03-23, released 2004-09-23
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-23, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin carboxyl-terminal hydrolase 25
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 2610101O11
  Database cross-references and differences (RAF-indexed):
  • Uniprot P57080 (7-73)
    • cloning artifact (0-6)
    • cloning artifact (74-79)
  Domains in SCOP 1.75: d1vdla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vdlA (A:)
  gssgssgmtveqnvlqqsaaqkhqqtflnqlreitgindaqilqqalkdsngnlelavaf
  ltaknaktppqeetsgpssg