PDB entry 1vdj

View 1vdj on RCSB PDB site
Description: Solution structure of actin-binding domain of troponin in Ca2+-bound state
Class: contractile protein
Keywords: troponin, actin, tropomyosin, CONTRACTILE PROTEIN
Deposited on 2004-03-22, released 2005-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Troponin I, fast skeletal muscle
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vdja1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vdjA (A:)
    kvnmdlranlkqvkkedtekekdlrdvgdwrknieeksgmegrkkmfeages