PDB entry 1vdh

View 1vdh on RCSB PDB site
Description: Structure-based functional identification of a novel heme-binding protein from thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: beta barrel, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-03-22, released 2004-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muconolactone isomerase-like protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vdha_
  • Chain 'B':
    Compound: muconolactone isomerase-like protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vdhb_
  • Chain 'C':
    Compound: muconolactone isomerase-like protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vdhc_
  • Chain 'D':
    Compound: muconolactone isomerase-like protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vdhd_
  • Chain 'E':
    Compound: muconolactone isomerase-like protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vdhe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vdhA (A:)
    merhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqg
    sygiyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekp
    ldpespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyq
    gevmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkylde
    ealraflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdhA (A:)
    rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy
    giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld
    pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge
    vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea
    lraflgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vdhB (B:)
    merhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqg
    sygiyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekp
    ldpespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyq
    gevmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkylde
    ealraflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdhB (B:)
    rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy
    giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld
    pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge
    vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea
    lraflgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vdhC (C:)
    merhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqg
    sygiyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekp
    ldpespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyq
    gevmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkylde
    ealraflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdhC (C:)
    rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy
    giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld
    pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge
    vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea
    lraflgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vdhD (D:)
    merhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqg
    sygiyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekp
    ldpespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyq
    gevmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkylde
    ealraflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdhD (D:)
    rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy
    giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld
    pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge
    vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea
    lraflgl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vdhE (E:)
    merhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqg
    sygiyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekp
    ldpespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyq
    gevmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkylde
    ealraflgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdhE (E:)
    rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy
    giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld
    pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge
    vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea
    lraflgl