PDB entry 1vdg

View 1vdg on RCSB PDB site
Description: Crystal structure of LIR1.01, one of the alleles of LIR1
Class: immune system
Keywords: immunoglobulin-like, IMMUNE SYSTEM
Deposited on 2004-03-22, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.241
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukocyte immunoglobulin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdga1, d1vdga2
  • Chain 'B':
    Compound: Leukocyte immunoglobulin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdgb1, d1vdgb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vdgA (A:)
    ghlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktalwitripqelvkkgqf
    pipsitwehagryrcyygsdtagrsessdplelvvtgayikptlsaqpspvvnsggnvil
    qcdsqvafdgfslckegedehpqclnsqphargssraifsvgpvspsrrwwyrcyaydsn
    spyewslpsdllellvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdgA (A:)
    ghlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktalwitripqelvkkgqf
    pipsitwehagryrcyyggrsessdplelvvtgayikptlsaqpspvvnsggnvilqcds
    qvafdgfslckeqclnsqphargssraifsvgpvspsrrwwyrcyaydsnspyewslpsd
    llellvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vdgB (B:)
    ghlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktalwitripqelvkkgqf
    pipsitwehagryrcyygsdtagrsessdplelvvtgayikptlsaqpspvvnsggnvil
    qcdsqvafdgfslckegedehpqclnsqphargssraifsvgpvspsrrwwyrcyaydsn
    spyewslpsdllellvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdgB (B:)
    ghlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktalwitripqelvkkgqf
    pipsitwehagryrcyygsdagrsessdplelvvtgayikptlsaqpspvvnsggnvilq
    cdsqvafdgfslckeqclnsqprgssraifsvgpvspsrwwyrcyaydsnspyewslpsd
    llellvl