PDB entry 1vdf

View 1vdf on RCSB PDB site
Description: assembly domain of cartilage oligomeric matrix protein
Class: extracellular matrix protein
Keywords: extracellular matrix protein, assembly domain, cartilage, oligomeric matrix protein, glycoprotein
Deposited on 1996-09-12, released 1997-10-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.176
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cartilage oligomeric matrix protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35444 (1-45)
    • conflict (26-27)
  Domains in SCOPe 2.08: d1vdfa_
• Chain 'B':
  Compound: cartilage oligomeric matrix protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35444 (1-45)
    • conflict (26-27)
  Domains in SCOPe 2.08: d1vdfb_
• Chain 'C':
  Compound: cartilage oligomeric matrix protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35444 (1-45)
    • conflict (26-27)
  Domains in SCOPe 2.08: d1vdfc_
• Chain 'D':
  Compound: cartilage oligomeric matrix protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35444 (1-45)
    • conflict (26-27)
  Domains in SCOPe 2.08: d1vdfd_
• Chain 'E':
  Compound: cartilage oligomeric matrix protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35444 (1-45)
    • conflict (26-27)
  Domains in SCOPe 2.08: d1vdfe_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vdfA (A:)
  mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vdfB (B:)
  mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vdfC (C:)
  mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vdfD (D:)
  mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vdfE (E:)
  mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg