PDB entry 1vdf

View 1vdf on RCSB PDB site
Description: assembly domain of cartilage oligomeric matrix protein
Class: extracellular matrix protein
Keywords: extracellular matrix protein, assembly domain, cartilage, oligomeric matrix protein, glycoprotein
Deposited on 1996-09-12, released 1997-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.176
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cartilage oligomeric matrix protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35444 (1-45)
      • conflict (26-27)
    Domains in SCOPe 2.07: d1vdfa_
  • Chain 'B':
    Compound: cartilage oligomeric matrix protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35444 (1-45)
      • conflict (26-27)
    Domains in SCOPe 2.07: d1vdfb_
  • Chain 'C':
    Compound: cartilage oligomeric matrix protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35444 (1-45)
      • conflict (26-27)
    Domains in SCOPe 2.07: d1vdfc_
  • Chain 'D':
    Compound: cartilage oligomeric matrix protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35444 (1-45)
      • conflict (26-27)
    Domains in SCOPe 2.07: d1vdfd_
  • Chain 'E':
    Compound: cartilage oligomeric matrix protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35444 (1-45)
      • conflict (26-27)
    Domains in SCOPe 2.07: d1vdfe_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vdfA (A:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vdfB (B:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vdfC (C:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vdfD (D:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vdfE (E:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg