PDB entry 1vde

View 1vde on RCSB PDB site
Description: pi-scei, a homing endonuclease with protein splicing activity
Class: endonuclease
Keywords: homing endonuclease, protein splicing
Deposited on 1997-04-01, released 1998-04-08
The last revision prior to the SCOP 1.73 freeze date was dated 1998-04-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pi-scei
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vdea1, d1vdea2, d1vdea3
  • Chain 'B':
    Compound: pi-scei
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vdeb1, d1vdeb2, d1vdeb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vdeA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdeA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlevitfemgqkkapdgrivelvkevsksy
    pisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhff
    dymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlca
    eykdrkepqvaktvnlyskvlntenplwdaivglgflkdgvknipsflstdnigtretfl
    aglidsdgyvtdehgikatiktihtsvrdglvslarslglvvsvnaepatkhkisyaiym
    sggdvllnvlskcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqfl
    lanqvvvhn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vdeB (B:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdeB (B:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlevitfemgqkkapdgrivelvkevsksy
    pisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhff
    dymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlca
    eykdrkepqvaktvnlysklntenplwdaivglgflkdgvknipsflstdnigtretfla
    glidsdgyvtdehgikatiktihtsvrdglvslarslglvvsvnaepatkhkisyaiyms
    ggdvllnvlskcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqfll
    anqvvvhn