PDB entry 1vde

View 1vde on RCSB PDB site
Description: pi-scei, a homing endonuclease with protein splicing activity
Deposited on 1997-04-01, released 1998-04-08
The last revision prior to the SCOP 1.69 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vdeA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdeA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlevitfemgqkkapdgrivelvkevsksy
    pisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhff
    dymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlca
    eykdrkepqvaktvnlyskvlntenplwdaivglgflkdgvknipsflstdnigtretfl
    aglidsdgyvtdehgikatiktihtsvrdglvslarslglvvsvnaepatkhkisyaiym
    sggdvllnvlskcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqfl
    lanqvvvhn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vdeB (B:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdeB (B:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlevitfemgqkkapdgrivelvkevsksy
    pisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhff
    dymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlca
    eykdrkepqvaktvnlysklntenplwdaivglgflkdgvknipsflstdnigtretfla
    glidsdgyvtdehgikatiktihtsvrdglvslarslglvvsvnaepatkhkisyaiyms
    ggdvllnvlskcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqfll
    anqvvvhn