PDB entry 1vdc

View 1vdc on RCSB PDB site
Description: structure of nadph dependent thioredoxin reductase
Deposited on 1996-09-22, released 1997-03-12
The last revision prior to the SCOP 1.57 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vdc_ (-)
    lethntrlcivgsgpaahtaaiyaaraelkpllfegwmandiapggqlttttdvenfpgf
    pegilgveltdkfrkqserfgttiftetvtkvdfsskpfklftdskailadavilaigav
    akrlsfvgsgevlggfwnrgisacavcdgaapifrnkplavigggdsameeanfltkygs
    kvyiihrrdafraskimqqralsnpkidviwnssvveaygdgerdvlgglkvknvvtgdv
    sdlkvsglffaighepatkfldggveldsdgyvvtkpgttqtsvpgvfaagdvqdkkyrq
    aitaagtgcmaaldaehylqei