PDB entry 1vdc

View 1vdc on RCSB PDB site
Description: structure of nadph dependent thioredoxin reductase
Class: oxidoreductase
Keywords: hypothetical protein, redox-active center, oxidoreductase, disulfide oxidoreductase, thioredoxin reductase, flavin adenine dinuleotide
Deposited on 1996-09-22, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadph dependent thioredoxin reductase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ATTHIREDB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39243
      • conflict (119)
      • conflict (134-135)
    Domains in SCOPe 2.07: d1vdca1, d1vdca2
  • Heterogens: SO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vdcA (A:)
    mnglethntrlcivgsgpaahtaaiyaaraelkpllfegwmandiapggqlttttdvenf
    pgfpegilgveltdkfrkqserfgttiftetvtkvdfsskpfklftdskailadavilai
    gavakrlsfvgsgevlggfwnrgisacavcdgaapifrnkplavigggdsameeanfltk
    ygskvyiihrrdafraskimqqralsnpkidviwnssvveaygdgerdvlgglkvknvvt
    gdvsdlkvsglffaighepatkfldggveldsdgyvvtkpgttqtsvpgvfaagdvqdkk
    yrqaitaagtgcmaaldaehylqeigsqegksd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdcA (A:)
    lethntrlcivgsgpaahtaaiyaaraelkpllfegwmandiapggqlttttdvenfpgf
    pegilgveltdkfrkqserfgttiftetvtkvdfsskpfklftdskailadavilaigav
    akrlsfvgsgevlggfwnrgisacavcdgaapifrnkplavigggdsameeanfltkygs
    kvyiihrrdafraskimqqralsnpkidviwnssvveaygdgerdvlgglkvknvvtgdv
    sdlkvsglffaighepatkfldggveldsdgyvvtkpgttqtsvpgvfaagdvqdkkyrq
    aitaagtgcmaaldaehylqei