PDB entry 1vd6

View 1vd6 on RCSB PDB site
Description: Crystal Structure of Glycerophosphoryl Diester Phosphodiesterase complexed with Glycerol
Class: hydrolase
Keywords: Glycerophosphoryl Diester Phosphodiesterase, Glycerophosphodiester Phosphodiesterase, Thermus thermophilus, HB8, Glycerol Complex, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2004-03-18, released 2005-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.217
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerophosphoryl diester phosphodiesterase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_145380 (Start-223)
    Domains in SCOPe 2.08: d1vd6a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vd6A (A:)
    mtafrqrplrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtp
    lgpvfqvdyadlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallr
    gregvwvssfdplallalrkaapglplgflmaedhsallpclgveavhphhalvteeava
    gwrkrglfvvawtvneegearrllalgldgligdrpevllplgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vd6A (A:)
    rplrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtplgpvfq
    vdyadlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallrgregvw
    vssfdplallalrkaapglplgflmaedhsallpclgveavhphhalvteeavagwrkrg
    lfvvawtvneegearrllalgldgligdrpevllplgg