PDB entry 1vd5

View 1vd5 on RCSB PDB site
Description: Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution
Class: hydrolase
Keywords: alpha-alpha-barrel, unsaturated glucuronyl hydrolase, hydrolase
Deposited on 2004-03-18, released 2004-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unsaturated glucuronyl hydrolase
    Species: Bacillus sp. [TaxId:84635]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vd5a_
  • Heterogens: GLY, DTT, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vd5A (A:)
    mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
    eqyregavrtvasfrerldrfenldhhdigflyslsakaqwivekdesarklaldaadvl
    mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
    rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
    dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
    perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
    llrlergvtgywyergr