PDB entry 1vd4

View 1vd4 on RCSB PDB site
Description: Solution structure of the zinc finger domain of TFIIE alpha
Class: Transcription
Keywords: ZINC FINGER, Transcription
Deposited on 2004-03-18, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor IIE, alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vd4a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vd4A (A:)
rietderdstnrasfkcpvcsstftdleanqlfdpmtgtfrctfchteveedesampkkd
ar