PDB entry 1vd3

View 1vd3 on RCSB PDB site
Description: Ribonuclease NT in complex with 2'-UMP
Class: hydrolase
Keywords: hydrolase, ribonuclease, nucleic acid, RNA
Deposited on 2004-03-18, released 2005-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNase NGR3
    Species: Nicotiana glutinosa [TaxId:35889]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vd3a_
  • Heterogens: U2P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vd3A (A:)
    yvefaqdfdffyfvqqwpasycdtrrsccypttgkpdedfsihglwpnyengkwpqncdr
    essldeseisdlistmeknwpslacpssdgvrfwshewlkhgtcsalgerayfqaaldfr
    kksnllenlknaeitprngehytlesikkaieegvghspyiecnvdtqgnhqiyqvylcv
    dktatdfidcpifphgrgcgskiefppfssesdhdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vd3A (A:)
    aqdfdffyfvqqwpasycdtrrsccypttgkpdedfsihglwpnyengkwpqncdressl
    deseisdlistmeknwpslacpssdgvrfwshewlkhgtcsalgerayfqaaldfrkksn
    llenlknaeitprngehytlesikkaieegvghspyiecnvdtqgnhqiyqvylcvdkta
    tdfidcpifphgrgcgskiefppf