PDB entry 1vd2

View 1vd2 on RCSB PDB site
Description: Solution Structure of the PB1 domain of PKCiota
Class: transferase
Keywords: Kinase, PB1 domain, OPCA motif, aPKC, ZIP/p62, MEK5, molecular recognition, transferase
Deposited on 2004-03-18, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C, iota type
    Species: Homo sapiens [TaxId:9606]
    Gene: PKCiota
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41743 (5-88)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d1vd2a1, d1vd2a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vd2A (A:)
    gplgsqvrvkayyrgdimithfepsisfeglcnevrdmcsfdneqlftmkwideegdpct
    vssqleleeafrlyelnkdsellihvfpc