PDB entry 1vd1

View 1vd1 on RCSB PDB site
Description: Crystal structure of RNase NT in complex with 5'-AMP
Class: hydrolase
Keywords: hydrolase, ribonuclease, Nucleic acid, RNA
Deposited on 2004-03-17, released 2005-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.226
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNase NGR3
    Species: Nicotiana glutinosa [TaxId:35889]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vd1a_
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vd1A (A:)
    yvefaqdfdffyfvqqwpasycdtrrsccypttgkpdedfsihglwpnyengkwpqncdr
    essldeseisdlistmeknwpslacpssdgvrfwshewlkhgtcsalgerayfqaaldfr
    kksnllenlknaeitprngehytlesikkaieegvghspyiecnvdtqgnhqiyqvylcv
    dktatdfidcpifphgrgcgskiefppfssesdhdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vd1A (A:)
    qdfdffyfvqqwpasycdtrrsccypttgkpdedfsihglwpnyengkwpqncdressld
    eseisdlistmeknwpslacpssdgvrfwshewlkhgtcsalgerayfqaaldfrkksnl
    lenlknaeitprngehytlesikkaieegvghspyiecnvdtqgnhqiyqvylcvdktat
    dfidcpifphgrgcgskiefppf