PDB entry 1vd0

View 1vd0 on RCSB PDB site
Description: Capsid stabilizing protein GPD, NMR, 20 Structures
Class: Viral protein
Keywords: Virus/Viral Protein, capsid protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, Scottish Structural Proteomics Facility, SSPF, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-03-17, released 2005-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Head decoration protein
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vd0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vd0A (A:)
    tsketfthyqpqgnsdpahtatapgglsakapamtplmldtssrklvawdgttdgaavgi
    lavaadqtsttltfyksgtfryedvlwpeaasdetkkrtafagtaisiv