PDB entry 1vcy

View 1vcy on RCSB PDB site
Description: VVA2 isoform
Class: toxin
Keywords: toxin
Deposited on 2004-03-17, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: volvatoxin A2
    Species: Volvariella volvacea [TaxId:36659]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcya_
  • Heterogens: MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcyA (A:)
    mseselkvnqavaaasddnvfqpvdqlpedlipssiqvlkfsgkylkleqnkayfdwpef
    ktaidnytgedlsfdkydqstinqreqevgsmvdkiakflrdafsavvdlsklgaiilnt
    ftnleeesssgflqfstnnvkknssweyrvlfsvpfgdnapsyfyslvttilitadieek
    tgwwgltsstkknfavqidalelvvkkgfkapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcyA (A:)
    nvfqpvdqlpedlipssiqvlkfsgkylkleqnkayfdwpefktaidnytgedlsfdkyd
    qstinqreqevgsmvdkiakflrdafsavvdlsklgaiilntftnleeesssgflqfstn
    nvkknssweyrvlfsvpfgapsyfyslvttilitadieektgwwgltsstkknfavqida
    lelvvkkgfkapn