PDB entry 1vcw

View 1vcw on RCSB PDB site
Description: Crystal structure of DegS after backsoaking the activating peptide
Class: hydrolase
Keywords: stress response, protein quality control, PDZ, UPR, HtrA, hydrolase
Deposited on 2004-03-16, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.233
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease degS
    Species: Escherichia coli [TaxId:562]
    Gene: DEGS, HHOB, HTRH, B3235, Z4594, ECS4108
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31137 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1vcwa1, d1vcwa2
  • Chain 'B':
    Compound: Protease degS
    Species: Escherichia coli [TaxId:562]
    Gene: DEGS, HHOB, HTRH, B3235, Z4594, ECS4108
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31137 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1vcwb1, d1vcwb2
  • Chain 'C':
    Compound: Protease degS
    Species: Escherichia coli [TaxId:562]
    Gene: DEGS, HHOB, HTRH, B3235, Z4594, ECS4108
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31137 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1vcwc1, d1vcwc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcwA (A:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    ksndgetpegigfaipfqlatkimdklirdgrvirgyigiggreiaplhaqgggidqlqg
    ivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgsvipvvvmrddkq
    ltlqvtiqeypatn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcwA (A:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    ksndgetpegigfaipfqlatkimdklirdgrvirgyigiggrgivvnevspdgpaanag
    iqvndliisvdnkpaisaletmdqvaeirpgsvipvvvqltlqvtiqeypa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vcwB (B:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    ksndgetpegigfaipfqlatkimdklirdgrvirgyigiggreiaplhaqgggidqlqg
    ivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgsvipvvvmrddkq
    ltlqvtiqeypatn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcwB (B:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    ksndgetpegigfaipfqlatkimdklirdgrvirgyigiggrgivvnevspdgpaanag
    iqvndliisvdnkpaisaletmdqvaeirpgsvipvvvqltlqvtiqeypa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vcwC (C:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    ksndgetpegigfaipfqlatkimdklirdgrvirgyigiggreiaplhaqgggidqlqg
    ivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgsvipvvvmrddkq
    ltlqvtiqeypatn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcwC (C:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    ksndgetpegigfaipfqlatkimdklirdgrvirgyigiggrgivvnevspdgpaanag
    iqvndliisvdnkpaisaletmdqvaeirpgsvipvvvqltlqvtiqeypa