PDB entry 1vcv

View 1vcv on RCSB PDB site
Description: Structure of 2-deoxyribose-5-phosphate aldolase from Pyrobaculum aerophilum
Class: lyase
Keywords: dera, aldolase, deoxyribose, hyperthermophile, archaea, 2-DEOXYRIBOSE-5-PHOSPHATE ALDOLASE
Deposited on 2004-03-15, released 2005-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable deoxyribose-phosphate aldolase
    Species: Pyrobaculum aerophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vcva1
  • Chain 'B':
    Compound: Probable deoxyribose-phosphate aldolase
    Species: Pyrobaculum aerophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vcvb1
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcvA (A:)
    mihlvdyallkpyltvdeavagarkaeelgvaaycvnpiyapvvrpllrkvklcvvadfp
    fgalptasrialvsrlaevadeidvvapiglvksrrwaevrrdlisvvgaaggrvvkvit
    eepylrdeerytlydiiaeagahfiksstgfaeeayaarqgnpvhstperaaaiaryike
    kgyrlgvkmaggirtreqakaivdaigwgedparvrlgtstpeall
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcvB (B:)
    mihlvdyallkpyltvdeavagarkaeelgvaaycvnpiyapvvrpllrkvklcvvadfp
    fgalptasrialvsrlaevadeidvvapiglvksrrwaevrrdlisvvgaaggrvvkvit
    eepylrdeerytlydiiaeagahfiksstgfaeeayaarqgnpvhstperaaaiaryike
    kgyrlgvkmaggirtreqakaivdaigwgedparvrlgtstpeall