PDB entry 1vct

View 1vct on RCSB PDB site
Description: Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii
Class: structural genomics, unknown function
Keywords: helix rich, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2004-03-12, released 2005-03-22
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.211
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein ph0236
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vcta1, d1vcta2
  • Heterogens: NA, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vctA (A:)
    meeveefkyepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyq
    lmmhsvlaarnvkeaeqvitilqianaiedisnaagdlakmvlegvelhpviketilege
    eiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpnenfkiragdvligr
    gtrtsidhlkeiargairvignera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vctA (A:)
    yepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvla
    arnvkeaeqvitilqianaiedisnaagdlakmvlegvelhpviketilegeeiigkiqv
    ypesvivgktlgeldlatntgvwiiavrrgkrwifgpnenfkiragdvligrgtrtsidh
    lkeiargairvig