PDB entry 1vcr

View 1vcr on RCSB PDB site
Description: an icosahedral assembly of light-harvesting chlorophyll a/b protein complex from pea thylakoid membranes
Deposited on 2004-03-10, released 2004-03-30
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 9.5 Å
R-factor: 0.379
AEROSPACI score: -0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1vcra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcrA (A:)
    rksattkkvassgspwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfsk
    nrelevihsrwamlgalgcvfpellsrngvkfgeavwfkagsqifseggldylgnpslvh
    aqsilaiwatqvilmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvke
    lkngrlamfsmfgffvqaivtgkgplenladhladpvnnnawsyatnfvpgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcrA (A:)
    petfsknrelevihsrwamlgalgcvfpellsrngsilaiwatqvilmgavegyripeaf
    aelkvkelkngrlamfsmfgffvqaivtgkgplenladhla