PDB entry 1vcr

View 1vcr on RCSB PDB site
Description: An icosahedral assembly of light-harvesting chlorophyll a/b protein complex from pea thylakoid membranes
Class: photosynthesis
Keywords: LHC-II, Icosahedron, chlorophyll, antenna, photosystem, PHOTOSYNTHESIS
Deposited on 2004-03-10, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 9.5 Å
R-factor: 0.379
AEROSPACI score: -0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chlorophyll a-b binding protein ab80
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcra_
  • Heterogens: CLA, CHL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcrA (A:)
    rksattkkvassgspwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfsk
    nrelevihsrwamlgalgcvfpellsrngvkfgeavwfkagsqifseggldylgnpslvh
    aqsilaiwatqvilmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvke
    lkngrlamfsmfgffvqaivtgkgplenladhladpvnnnawsyatnfvpgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcrA (A:)
    petfsknrelevihsrwamlgalgcvfpellsrngsilaiwatqvilmgavegyripeaf
    aelkvkelkngrlamfsmfgffvqaivtgkgplenladhla