PDB entry 1vcq

View 1vcq on RCSB PDB site
Description: semliki forest virus capsid protein (crystal form II)
Class: Viral protein
Keywords: VIRUS COAT PROTEIN, POLYPROTEIN, TRANSMEMBRANE, GLYCOPROTEIN, NUCLEOCAPSID PROTEIN, Viral protein
Deposited on 1996-03-04, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.157
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: semliki forest virus capsid protein
    Species: Semliki forest virus [TaxId:11033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcqa_
  • Chain 'B':
    Compound: semliki forest virus capsid protein
    Species: Semliki forest virus [TaxId:11033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcqA (A:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcqB (B:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew