PDB entry 1vcn

View 1vcn on RCSB PDB site
Description: Crystal Structure of T.th. HB8 CTP synthetase complex with Sulfate anion
Class: ligase
Keywords: Tetramer, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LIGASE
Deposited on 2004-03-10, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.248
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTP synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcna1, d1vcna2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcnA (A:)
    mngsadagprprkyvfitggvvsslgkgiltsslgallrargyrvtaikidpyvnvdagt
    mrpyehgevfvtadgaetdldighyerfldmdlsrgnnlttgqvylsviqkerrgeylsq
    tvqviphitdeikerirkvaeeqkaeivvvevggtvgdieslpfleairqfrfdegegnt
    lylhltlvpyletseefktkptqhsvatlrgvgiqpdilvlrsarpvpeevrrkvalftn
    vrpghvfssptvehlyevpllleeqglgraveralgleavipnlsfwqeavrvlkhpert
    vkiaiagkyvkmpdaylsllealrhagiknrarvevkwvdaesleaadldeafrdvsgil
    vpggfgvrgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganstefdpht
    phpvidlmpeqleveglggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnplyv
    dgleraglvvsattpgmrgrgaglveaielkdhpfflglqshpefksrpmrpsppfvgfv
    eaalayqera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcnA (A:)
    prkyvfitggvvsslgkgiltsslgallrargyrvtaikidpyvnvdagtmgevfvtadg
    aetdldighyerfldmdlsrgnnlttgqvylsviqkerrgeylsqtvqviphitdeiker
    irkvaeeqkaeivvvevggtvgdieslpfleairqfrfdegegntlylhltlvpyletse
    efktkptqhsvatlrgvgiqpdilvlrsarpvpeevrrkvalftnvrpghvfssptvhly
    evpllleeqglgraveralgleavipnlsfwqeavrvlhpertvkiaiagkpdaylslle
    alrhagiknrarvevkwvdaaadldeafrdvsgilvpggvrgiegkvraaqyarerkipy
    lgiclglqiaviefarnvaglkganstefdphtphpvidlmtmrlgdwpmrikpgtllhr
    lygkeevlerhrhryevnplyvdgleraglvvsattpgmgaglveaielkdhpfflglqs
    hpefksrpmrpsppfvgfveaalayq