PDB entry 1vcm

View 1vcm on RCSB PDB site
Description: Crystal Structure of T.th. HB8 CTP synthetase
Class: ligase
Keywords: Tetramer, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LIGASE
Deposited on 2004-03-10, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.235
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTP synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcma1, d1vcma2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcmA (A:)
    mngsadagprprkyvfitggvvsslgkgiltsslgallrargyrvtaikidpyvnvdagt
    mrpyehgevfvtadgaetdldighyerfldmdlsrgnnlttgqvylsviqkerrgeylsq
    tvqviphitdeikerirkvaeeqkaeivvvevggtvgdieslpfleairqfrfdegegnt
    lylhltlvpyletseefktkptqhsvatlrgvgiqpdilvlrsarpvpeevrrkvalftn
    vrpghvfssptvehlyevpllleeqglgraveralgleavipnlsfwqeavrvlkhpert
    vkiaiagkyvkmpdaylsllealrhagiknrarvevkwvdaesleaadldeafrdvsgil
    vpggfgvrgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganstefdpht
    phpvidlmpeqleveglggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnplyv
    dgleraglvvsattpgmrgrgaglveaielkdhpfflglqshpefksrpmrpsppfvgfv
    eaalayqera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcmA (A:)
    rprkyvfitggvvsslgkgiltsslgallrargyrvtaikidpyvnvdagtmrpyehgev
    fvtadgaetdldighyerfldmdlsrgnnlttgqvylsviqkerrgeylsqtvqviphit
    deikerirkvaeeqkaeivvvevggtvgdieslpfleairqfrfdegegntlylhltlvp
    ylseefktkptqhsvatlrgvgiqpdilvlrsarpvpeevrrkvalftnvrpghvfsspt
    vehlyevpllleeqglgraveralgleavipnlsfwqeavrvlkhpertvkiaiagkyvp
    daylsllealrhagiknrarvevkwvdaesaadldeafrdvsgilvpggfrgiegkvraa
    qyarerkipylgiclglqiaviefarnvaglkganstefdphtphpvidlmpeqlevegl
    ggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnplyvdgleraglvvsattpgm
    rgrgaglveaielkdhpfflglqshpefksrpmrpsppfvgfveaalayqe