PDB entry 1vcl

View 1vcl on RCSB PDB site
Description: Crystal Structure of Hemolytic Lectin CEL-III
Class: toxin
Keywords: LECTIN, CEL-III, HEMOLYSIS, HEMAGGLUTINATION, PORE-FORMING, CALCIUM, toxin
Deposited on 2004-03-09, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemolytic lectin CEL-III
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q868M7 (0-431)
      • modified residue (0)
      • see remark 999 (14-15)
      • see remark 999 (35)
      • see remark 999 (47)
      • see remark 999 (91)
      • see remark 999 (94)
      • see remark 999 (96)
      • see remark 999 (121)
      • see remark 999 (145)
      • see remark 999 (172)
      • see remark 999 (203)
      • see remark 999 (339)
      • see remark 999 (403)
    Domains in SCOPe 2.07: d1vcla1, d1vcla2, d1vcla3
  • Chain 'B':
    Compound: hemolytic lectin CEL-III
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q868M7 (0-431)
      • modified residue (0)
      • see remark 999 (14-15)
      • see remark 999 (35)
      • see remark 999 (47)
      • see remark 999 (91)
      • see remark 999 (94)
      • see remark 999 (96)
      • see remark 999 (121)
      • see remark 999 (145)
      • see remark 999 (172)
      • see remark 999 (203)
      • see remark 999 (339)
      • see remark 999 (403)
    Domains in SCOPe 2.07: d1vclb1, d1vclb2, d1vclb3
  • Heterogens: CA, MG, CL, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vclA (A:)
    evlctnpldigelrsfkskqcvdivgnqgsgniatydcdglsdqqiiicgdgtirnearn
    ycftpdgsgnanvmsspctlypeipssqrwrqgrrktftdnggieqvateiinlasgkcl
    diegsdgtgdigvydcqnlddqyfyvrsrgpelfygrlrneksdlcldvegsdgkgnvlm
    yscednldqwfryyengeivnaksgmcldvegsdgsgnvgiyrcddlrdqmwsrpnaycn
    gdycsflnkesnkcldvsgdqgtgdvgtwqcdglpdqrfkwvfddwevptatwnmvgcdq
    ngkvsqqisntisfsstvtagvavevsstiekgvifakatvsvkvtaslskawtnsqsgt
    taitytcdnydsdeeftrgcmwqlaiettevksgdllvwnpqivkctrsntapgcapftk
    canedctfctdi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vclB (B:)
    evlctnpldigelrsfkskqcvdivgnqgsgniatydcdglsdqqiiicgdgtirnearn
    ycftpdgsgnanvmsspctlypeipssqrwrqgrrktftdnggieqvateiinlasgkcl
    diegsdgtgdigvydcqnlddqyfyvrsrgpelfygrlrneksdlcldvegsdgkgnvlm
    yscednldqwfryyengeivnaksgmcldvegsdgsgnvgiyrcddlrdqmwsrpnaycn
    gdycsflnkesnkcldvsgdqgtgdvgtwqcdglpdqrfkwvfddwevptatwnmvgcdq
    ngkvsqqisntisfsstvtagvavevsstiekgvifakatvsvkvtaslskawtnsqsgt
    taitytcdnydsdeeftrgcmwqlaiettevksgdllvwnpqivkctrsntapgcapftk
    canedctfctdi