PDB entry 1vck

View 1vck on RCSB PDB site
Description: Crystal structure of ferredoxin component of carbazole 1,9a-dioxygenase of Pseudomonas resinovorans strain CA10
Deposited on 2004-03-09, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin component of carbazole
    Species: Pseudomonas resinovorans [TaxId:53412]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, FES, H2S, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vckA (A:)
    mnqiwlkvcaasdmqpgtirrvnrvgaaplavyrvgdqfyatedtcthgiaslsegtldg
    dviecpfhggafnvctgmpasspctvplgvfevevkegevyvagekklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1vckA (A:)
    iwlkvcaasdmqpgtirrvnrvgaaplavyrvgdqfyatedtcthgiaslsegtldgdvi
    ecpfhggafnvctgmpasspctvplgvfevevkegevyvagekk