PDB entry 1vcj

View 1vcj on RCSB PDB site
Description: Influenza B virus neuraminidase complexed with 1-(4-Carboxy-2-(3-pentylamino)phenyl)-5-aminomethyl-5-hydroxymethyl-pyrrolidin-2-one
Class: hydrolase
Keywords: neuraminidase, benzoic acid inhibitors, small molecule inhibitor, protein-inhibitor complex, HYDROLASE
Deposited on 2004-03-09, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza B virus (B/Lee/40) [TaxId:107412]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03474 (0-388)
      • conflict (304)
    Domains in SCOPe 2.07: d1vcja_
  • Heterogens: IBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcjA (A:)
    pewtyprlscqgstfqkallisphrfgeikgnsapliirepfvacgpkecrhfalthyaa
    qpggyyngtrkdrnklrhlvsvklgkiptvensifhmaawsgsachdgrewtyigvdgpd
    ndalvkikygeaytdtyhsyahnilrtqesacnciggdcylmitdgsasgiskcrflkir
    egriikeilptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctktyldtprpddgsiagpcesngdkwlggikggfvhqrmaskigrwysrtmsktnrmgm
    elyvrydgdpwtdsdaltlsgvmvsieepgwysfgfeikdkkcdvpcigiemvhdggkdt
    whsaataiyclmgsgqllwdtvtgvdmal