PDB entry 1vci

View 1vci on RCSB PDB site
Description: Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3 complexed with ATP
Class: transport protein
Keywords: ABC transporter, sugar-binding, ATPase, TRANSPORT PROTEIN
Deposited on 2004-03-08, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.215
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sugar-binding transport ATP-binding protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcia1, d1vcia2, d1vcia3
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vciA (A:)
    mgnnievikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiag
    leeptegriyfgdrdvtylppkdrnismvfqsyavwphmtvyeniafplkikkfpkdeid
    krvrwaaellqieellnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrva
    mraeikklqqklkvttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfva
    tfigapemnilevsvgdgylegrgfrielpqdlmdllkdyvgktvlfgirpehmtvegvs
    elahmkrtarligkvdfvealgtdtilhvkfgdelvkvklpghipiepgrevkvimdldm
    ihvfdkdtekaiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vciA (A:)
    vikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiagleepte
    griyfgdrdvtylppkdrnismvfqhmtvyeniafplkkfpkdeidkrvrwaaellqiee
    llnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrvamraeikklqqklkv
    ttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfvatfigapemnilevs
    vgdgylegrgfrielpqmdllkdyvgktvlfgirpehmtvegvhmkrtarligkvdfvea
    lgtdtilhvkfgdelvkvklpghipiepgrevkvimdldmihvfdkdtekaiv