PDB entry 1vch

View 1vch on RCSB PDB site
Description: Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus
Class: transferase
Keywords: transferase, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-03-08, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.232
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosyltransferase-related protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcha1
  • Chain 'B':
    Compound: Phosphoribosyltransferase-related protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vchb_
  • Chain 'C':
    Compound: Phosphoribosyltransferase-related protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vchc_
  • Chain 'D':
    Compound: Phosphoribosyltransferase-related protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vchd_
  • Chain 'E':
    Compound: Phosphoribosyltransferase-related protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vche_
  • Heterogens: CL, CA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vchA (A:)
    metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
    tspiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaeklln
    qrvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vchA (A:)
    etypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilfttet
    spiplthvlaealglpyvvarrrrrpymedpiiqevqtgevlwldrrfaekllnqrvvlv
    sdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vchB (B:)
    metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
    tspiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaeklln
    qrvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vchB (B:)
    metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
    tspiplthvlaealglpyvvarrrrrpymedpiiqevqtgevlwldrrfaekllnqrvvl
    vsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vchC (C:)
    metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
    tspiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaeklln
    qrvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vchC (C:)
    metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
    tspiplthvlaealglpyvvarrrrrpymedpiiqevqtgevlwldrrfaekllnqrvvl
    vsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vchD (D:)
    metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
    tspiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaeklln
    qrvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vchD (D:)
    metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
    tspiplthvlaealglpyvvarrrrrpymedpiiqevqtltvgevlwldrrfaekllnqr
    vvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vchE (E:)
    metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
    tspiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaeklln
    qrvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vchE (E:)
    etypitvggvtrhvplieplpgrriplvefpeftraaaealrplvpkeaeilfttetspi
    plthvlaepyvvarrrrrpymedpiiqegevlwldrrfaeklqrvvlvsdvvastmramk
    mvlragghvrlavfrqgtpglavdtvaelpvl