PDB entry 1vcf

View 1vcf on RCSB PDB site
Description: Crystal Structure of IPP isomerase at I422
Class: isomerase
Keywords: TIM barrel, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ISOMERASE
Deposited on 2004-03-08, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.242
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q746I8 (Start-331)
      • modified residue (65)
      • modified residue (90-91)
      • modified residue (142)
      • modified residue (184)
    Domains in SCOPe 2.08: d1vcfa1
  • Chain 'B':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q746I8 (Start-331)
      • modified residue (65)
      • modified residue (90-91)
      • modified residue (142)
      • modified residue (184)
    Domains in SCOPe 2.08: d1vcfb_
  • Heterogens: CD, FMN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcfA (A:)
    mnirerkrkhleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkap
    fligamtggeengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkall
    ianlglaqlrrygrddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellpl
    pfpvmvkevghglsreaalalrdlplaavdvagaggtswarveewvrfgevrhpelceig
    iptarailevrevlphlplvasggvytgtdgakalalgadllavarpllrpalegaerva
    awigdyleelrtalfaigarnpkeargrverv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcfA (A:)
    ktttglegfrlryqalaglalsevdlttpflgktlkapfligamtengerinlalaeaae
    algvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygrddllrlvemle
    adalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalalrdlp
    laavdvagaggtswarveewvelceigiptarailevrevlphlplvasggvytgtdgak
    alalgadllavarpllrpalegaervaawigdyleelrtalfaigarnpkeargrverv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vcfB (B:)
    mnirerkrkhleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkap
    fligamtggeengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkall
    ianlglaqlrrygrddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellpl
    pfpvmvkevghglsreaalalrdlplaavdvagaggtswarveewvrfgevrhpelceig
    iptarailevrevlphlplvasggvytgtdgakalalgadllavarpllrpalegaerva
    awigdyleelrtalfaigarnpkeargrverv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcfB (B:)
    ktttglegfrlryqalaglalsevdlttpflgktlkapfligamtggeengerinlalae
    aaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygrddllrlve
    mleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalalr
    dlplaavdvagaggtswarvelceigiptarailevrevlphlplvasggvytgtdgaka
    lalgadllavarpllrpalegaervaawigdyleelrtalfaigarnpkeargrverv