PDB entry 1vce

View 1vce on RCSB PDB site
Description: Crystal structure of project ID PH0725 from Pyrococcus horikoshii OT3
Class: Transferase
Keywords: Transferase, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-03-07, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphthine synthase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0725
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58456 (0-264)
      • modified residue (0)
      • modified residue (38)
      • modified residue (173)
      • modified residue (175)
      • modified residue (181)
      • modified residue (190)
    Domains in SCOPe 2.07: d1vcea1
  • Chain 'B':
    Compound: diphthine synthase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0725
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58456 (0-264)
      • modified residue (0)
      • modified residue (38)
      • modified residue (173)
      • modified residue (175)
      • modified residue (181)
      • modified residue (190)
    Domains in SCOPe 2.07: d1vceb_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vceA (A:)
    mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
    edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
    gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
    amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
    klhiveaeylveiagapreilrvnv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vceB (B:)
    mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
    edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
    gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
    amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
    klhiveaeylveiagapreilrvnv