PDB entry 1vcd

View 1vcd on RCSB PDB site
Description: Crystal Structure of a T.thermophilus HB8 Ap6A hydrolase Ndx1
Class: hydrolase
Keywords: Nudix protein, diadenosine polyphosphate, Ap6A, Thermus thermophilus HB8, hydrolase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-03-05, released 2005-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.214
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ndx1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: ndx1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vcda_
  • Chain 'B':
    Compound: Ndx1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: ndx1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vcdb_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vcdA (A:)
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vcdB (B:)
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl