PDB entry 1vcc

View 1vcc on RCSB PDB site
Description: amino terminal 9kda domain of vaccinia virus DNA topoisomerase I residues 1-77, experimental electron density for residues 1-77
Class: DNA binding
Keywords: DNA binding
Deposited on 1995-10-02, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.218
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: Vaccinia virus [TaxId:10254]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vcca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vccA (A:)
    mralfykdgklftdnnflnpvsddnpayevlqhvkipthltdvvvyeqtweealtrlifv
    gsdskgrrqyfygkmhv