PDB entry 1vcb

View 1vcb on RCSB PDB site
Description: the vhl-elonginc-elonginb structure
Class: transcription
Keywords: tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation
Deposited on 1999-03-13, released 1999-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.238
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (elongin b)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcba_
  • Chain 'B':
    Compound: protein (elongin c)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbb_
  • Chain 'C':
    Compound: protein (vhl)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbc_
  • Chain 'D':
    Compound: protein (elongin b)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbd_
  • Chain 'E':
    Compound: protein (elongin c)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbe_
  • Chain 'F':
    Compound: protein (vhl)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbf_
  • Chain 'G':
    Compound: protein (elongin b)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbg_
  • Chain 'H':
    Compound: protein (elongin c)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbh_
  • Chain 'I':
    Compound: protein (vhl)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbi_
  • Chain 'J':
    Compound: protein (elongin b)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbj_
  • Chain 'K':
    Compound: protein (elongin c)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbk_
  • Chain 'L':
    Compound: protein (vhl)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcbl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcbA (A:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbA (A:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vcbB (B:)
    mdgeektyggcegpdamyvklissdghefivkrehaltsgtikamlsgpgqfaenetnev
    nfreipshvlskvcmyftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbB (B:)
    myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vcbC (C:)
    meagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyr
    ghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpe
    nyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbC (C:)
    lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
    gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
    slyedledhpnvqkdlerltqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vcbD (D:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbD (D:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vcbE (E:)
    mdgeektyggcegpdamyvklissdghefivkrehaltsgtikamlsgpgqfaenetnev
    nfreipshvlskvcmyftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbE (E:)
    myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vcbF (F:)
    meagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyr
    ghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpe
    nyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbF (F:)
    lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
    gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
    slyedledhpnvqkdlerltqe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vcbG (G:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbG (G:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vcbH (H:)
    mdgeektyggcegpdamyvklissdghefivkrehaltsgtikamlsgpgqfaenetnev
    nfreipshvlskvcmyftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbH (H:)
    myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1vcbI (I:)
    meagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyr
    ghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpe
    nyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbI (I:)
    lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
    gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
    slyedledhpnvqkdlerltqe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1vcbJ (J:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbJ (J:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1vcbK (K:)
    mdgeektyggcegpdamyvklissdghefivkrehaltsgtikamlsgpgqfaenetnev
    nfreipshvlskvcmyftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbK (K:)
    myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1vcbL (L:)
    meagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyr
    ghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpe
    nyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcbL (L:)
    lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
    gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
    slyedledhpnvqkdlerltqe