PDB entry 1vca

View 1vca on RCSB PDB site
Description: crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution
Class: cell adhesion protein
Keywords: immunoglobulin superfamily, integrin-binding, cell adhesion protein
Deposited on 1995-03-21, released 1995-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human vascular cell adhesion molecule-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcaa1, d1vcaa2
  • Chain 'B':
    Compound: human vascular cell adhesion molecule-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vcab1, d1vcab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcaA (A:)
    fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
    vsfgnehsylctatcesrklekgiqveiysfpkdpeihlsgpleagkpitvkcsvadvyp
    fdrleidllkgdhlmksqefledadrksletkslevtftpviedigkvlvcraklhidem
    dsvptvrqavkelqvyispknt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcaA (A:)
    fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
    vsfgnehsylctatcesrklekgiqveiysfpkdpeihlsgpleagkpitvkcsvadvyp
    fdrleidllkgdhlmksqefledadrksletkslevtftpviedigkvlvcraklhidem
    dsvptvrqavkelqvyisp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vcaB (B:)
    fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
    vsfgnehsylctatcesrklekgiqveiysfpkdpeihlsgpleagkpitvkcsvadvyp
    fdrleidllkgdhlmksqefledadrksletkslevtftpviedigkvlvcraklhidem
    dsvptvrqavkelqvyispknt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcaB (B:)
    fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
    vsfgnehsylctatcesrklekgiqveiysfpkdpeihlsgpleagkpitvkcsvadvyp
    fdrleidllkgdhlmksqefledadrksletkslevtftpviedigkvlvcraklhidem
    dsvptvrqavkelqvyisp