PDB entry 1vc9

View 1vc9 on RCSB PDB site
Description: Crystal Structure of a T.thermophilus HB8 Ap6A hydrolase E50Q mutant-Mg2+-ATP complex
Class: hydrolase
Keywords: Nudix protein, diadenosine polyphosphate, Ap6A, Thermus thermophilus HB8, hydrolase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-03-05, released 2005-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ndx1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: ndx1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75UV1 (0-125)
      • engineered (49)
    Domains in SCOPe 2.08: d1vc9a1
  • Chain 'B':
    Compound: Ndx1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: ndx1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75UV1 (0-125)
      • engineered (49)
    Domains in SCOPe 2.08: d1vc9b_
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vc9A (A:)
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweqtgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vc9B (B:)
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweqtgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl