PDB entry 1vc4

View 1vc4 on RCSB PDB site
Description: Crystal Structure of Indole-3-Glycerol Phosphate Synthase (TrpC) from Thermus Thermophilus At 1.8 A Resolution
Class: Lyase
Keywords: Lyase, Tryptophan Biosynthesis, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-03-04, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: indole-3-glycerol phosphate synthase
    Species: Thermus thermophilus [TaxId:274]
    Gene: TRPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vc4a_
  • Chain 'B':
    Compound: indole-3-glycerol phosphate synthase
    Species: Thermus thermophilus [TaxId:274]
    Gene: TRPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vc4b_
  • Heterogens: SO4, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vc4A (A:)
    mrpdlsrvpgvlgeiarkrasevapyplpeppsvpsfkeallrpglsviaevkrqspseg
    lirevdpveaalayarggaravsvltephrfggslldlkrvreavdlpllrkdfvvdpfm
    leearafgasaallivallgeltgayleearrlglealvevhtereleialeagaevlgi
    nnrdlatlhinletaprlgrlarkrgfggvlvaesgysrkeelkaleglfdavligtslm
    rapdleaalrelvg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vc4B (B:)
    mrpdlsrvpgvlgeiarkrasevapyplpeppsvpsfkeallrpglsviaevkrqspseg
    lirevdpveaalayarggaravsvltephrfggslldlkrvreavdlpllrkdfvvdpfm
    leearafgasaallivallgeltgayleearrlglealvevhtereleialeagaevlgi
    nnrdlatlhinletaprlgrlarkrgfggvlvaesgysrkeelkaleglfdavligtslm
    rapdleaalrelvg