PDB entry 1vc3

View 1vc3 on RCSB PDB site
Description: Crystal Structure of L-Aspartate-alpha-Decarboxylase
Deposited on 2004-03-04, released 2005-06-28
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.215
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-Aspartate-alpha-Decarboxylase light chain
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: L-Aspartate-alpha-Decarboxylase heavy chain
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed):
    • PDB 1VC3 (0-95)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1vc3A (A:)
    mkrvmfhakihratvtqadlhyvg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1vc3B (B:)
    xvtvdqdlldaagilpfeqvdiyditngarlttyalpgergsgvigingaaahlvkpgdl
    vilvaygvfdeeearnlkptvvlvdernrilevrkg